Best Dressed — 2017 Emmy’s

My top looks for the 2017 Emmy Awards red carpet!!

JAIMIE ALEXANDER

JULIANNE HOUGH

VANESSA KIRBY

MANDY MOORE

RUBY MODINE

NASTIA LIUKIN

JENNIFER NETTLES

MADELINE BREWER

FELICITY HUFFMAN

GINA RODRIGUEZ

THANDIE NEWTON

SOFIA VERGARA

AMANDA CREW

ANNA FARIS

GUGU MBATHA-RAW

ZOE KRAVITZ

ANNA CHLUMSKY

ALEXIS BLEDEL

LEA MICHELE

LAURA DERN

MILLIE BOBBY BROWN

MICHELLE PFEIFFER

EMMY ROSSUM

TESSA THOMPSON

SAMIRA WILEY & LAUREN MORELLI

HILARIA & ALEC BALDWIN

JUSTIN HARTLEY

CALEB MCLAUGHLIN

JESSIE TYLER FERGUSON

JEREMY MAGUIRE

 

2017 VMAs — Best Dressed

My top looks from the 2017 MTV Video Music Awards!!

HAILEY BALDWIN

JULIA MICHAELS

  • Dior sparkling ombre blue gown

OLIVIA MUNN

DEMI LOVATO

LORDE

Wearing Monique Lhuillier

makeup artist Amber Dreadon

FIFTH HARMONY

CHRISTINA MILIAN

LAURA MARANO

AMBER ROSE

Dress by @yousef_aljasmi
Styled by @sethchernoff
Hair @philonhair
Makeup 💄 @bryanmendez
Nails @nailedbylexi

Hearts on Fire rings & Butani earrings

ANDREA RUSSETT

Wearing Steven Khalil

PARIS JACKSON

AMBER PORTWOOD

JURNEE SMOLLETT-BELL

FALL OUT BOY

LUDACRIS & EUDOXIE AGNAN

For Eudoxie —

SHAWN MENDES

Wearing Armani

ASHAD KHALED

Wearing Gucci

TYLER POSEY

 

BMAs & Network Upfronts 2017

The Cannes red carpets have been hosting some stunning looks, but in the midst of the glamour abroad, there has also been some across the U.S. — the 2017 Billboard Music Awards & various network TV upfronts. Here are my faves!!

Kate Beckinsale

Various Looks from Vanessa Hudgens

Wood spritzed her damp strands with TONI&GUY — Hair by Chad Wood

Olivia Munn

Madison Beer

Lea Michele

Josh Duhamel

Forever in Your Mind

BTS

UPFRONTS

Lili Reinhart

Jenna Dewan-Tatum

Met Gala 2017 — Best of the Best

Each year, the Metropolitan Museum of Art puts on an annual Costume Institute exhibit and this year’s exhibit focuses on designer Rei Kawakubo, Comme des Garçons, and “the art of the in-between.” It pays tribute to Rei Kawakubo, the legendary designer behind Commes Des Garçons. Kawakubo is known for her risk-taking, out-of-the-box aesthetic, and attendees channeled that with a stream of crazed beauty looks and extreme gowns/dresses. Here are my top pics!

BLAKE LIVELY

EMILY RATAJKOWSKI

BRIE LARSON

Larson’s hairstylist Mara Roszak misted her hair with L’Oréal Paris Advanced Hairstyle Sleek It Strand Smoother Serum-Spray for the intense shine.

HALLE BERRY

SOPHIE TURNER

  • a white-and-silver lace Louis Vuitton gown with gold panels on the bodice

ANNA WINTOUR

SELENA GOMEZ

  • makeup artist Hung Vanngo — one of the most eye-catching makeup looks of the evening: An electrifying, hot pink smoky eye created by makeup artist Hugo Vanngo. “The twist was the bright pink Marc Jacobs Beauty eyeliner I came across while sorting through colors”
  • Tiffany & Co.
  • cream Coach gown

KYLIE JENNER

CASSIE

KERRY WASHINGTON

RILEY KEOUGH

BEE SHAFFER

REESE WITHERSPOON

KRISTIN CAVALLARI

FELICITY JONES

  • a periwinkle Old West-inspired custom Erdem gown with a bustle, ruffles and high neck

LILY COLLINS

a base of Lancôme Le Crayon Khol in Black Ebony (yep, that’s an eyeliner) then layer Lancôme L’Absolu Rouge Lipstick in 397 Berry Noir on top. (makeup by Fiona Stiles)

FRANCES BEAN

LALA ANTHONY

ZENDAYA

HAILEY BALDWIN

KATIE HOLMES

  • deep teal off-the-shoulder Zac Posen

NICK JONAS

  • jacquard tux and smoking slippers by Ralph Lauren Purple Label

 

Other Fave Oscars Related Looks

The Oscars is not all about the main red carpet, there is the Vanity Fair afterparty, the Elton John AIDS Foundation party (aka the Oscars viewing party), The Weinstein Co. afterparty, and the Independent Spirit Awards, all part of the Oscars weekend. What does this mean? There are so many more looks to fall in love with and here are my top picks!

KATE BOSWORTH

HAILEE STEINFELD

EMMA ROBERTS

SAVANNAH CHRISLEY

KATE HUDSON

SOFIA VERGARA

HEIDI KLUM

DEMI LOVATO

PETRA NEMCOVA

LEONA LEWIS

PORTIA DOUBLEDAY

LILY COLLINS

NINA AGDAL

THANDIE NEWTON

EMILY RATAJKOWSKI

RASHIDA JONES

ROSIE HUNTINGTON-WHITELEY

FELICITY JONES

  • a dark eggplant sequin short-sleeve Erdem gown with floral motif

NAOMIE HARRIS

2017 Oscars — Best Dressed

I guess it is safe to say that nude-toned gowns, or ones with sheer effects most caught my eye! Here is the best of the best though in my book!

HAILEE STEINFELD

  • Ralph & Russo gown with ruffle neckline and watercolor floral print with metallic details
  • Neil Lane jewelry, total value in fact $750K, including a 10-carat diamond-and-platinum studs, a 10-carat diamond-and-platinum line bracelet and a 25-carat oval link diamond-and-platinum bracelet worth $250,000.
  • smoky eye by makeup artist Mary Phillips
  • use of Essie nail polish

SOFIA CARSON

EMMA STONE

EMMA ROBERTS

NICOLE KIDMAN

  • custom pale apricot Armani Privé gown with arabesque embroidery
  • nude Stuart Weitzman heels
  • Harry Winston jewelry, total Carat count, 119 — including 30.60-carat cluster diamond-and-spinel drop earrings (valued at $235,000), 44.03-carat vintage cluster diamond bracelet, a 31.59-carat splash diamond bracelet and 13.58-carat pear-shaped diamond ring
  • Omega watch

In an exciting swap from her usual nude lip, Nicole Kidman went for a bold, crimson hue that makeup artist Jeanine Lobell creating using Giorgio Armani lipstick in #402, followed by a dab of Neutrogena Hydro Boost Hydrating Lip Shine in Deep Cherry.

HALLE BERRY

GEORGINA CHAPMAN

SARA BAREILLES

CHRISSY TEIGEN

ROBIN ROBERTS

JESSICA OYELOWO

ZURI HALL

ROSALIND ROSS

Mel looks okay too!

CHRIS EVANS

 

2017 Grammy Awards — Best Dressed

Lots to see from the 2017 Grammy Awards, but also the 2017 BAFTAs. Here are my faves —

CAMILA CABELLO

KELSEA BALLERINI

LAUREN DAIGLE

KATHARINE MCPHEE

KRISTIN CAVALLARI

JANE ZHANG

HILARY SCOTT

LITTLE BIG TOWN

ENYA

BROOKLYN & BAILEY MCKNIGHT

  • Trying out the So Lashy Mascara by CoverGirl

KRIS JENNER

JULIA STILES

PRINCE WILLIAM & KATE

EMILY BLUNT & JOHN KRASINSKI

EDDIE REDMAYNE & wife HANNAH BAGSHAWE

CARMEN EJOGO

  • Emanuel Ungaro gown

Globes AfterParties — Best of the Best

The Golden Globes main red carpet was phenomenal, but so too were the various looks from the whole Golden Globes weekend, the Art of Elysium Gala, W Mag’s It Girl luncheon, and afterparties from HBO, InStyle & Warner Bros., and Netflix. Enjoy!

Angela Sarafyan

Lucy Hale

Nikki Reed

Naomie Harris

Maya Henry

Constance Wu

Sophia Bush

Kristen Bell

Amanda Crew

Jenna Dewan-Tatum

Halston Sage

Zoey Deutch

Mandy Moore

Vanessa Hudgens

Lisa Rinna

Shanina Shaik

Hailey Baldwin

Caitriona Balfe

 

Golden Globes 2017 — Best Dressed

At the end of 2016, I had such joy in looking back at all of the red carpets throughout the year. So it seems only fitting that one of my first posts of the new year is a best dressed list, the 2017 Golden Globes Awards to be precise. I think some of these looks will be remembered all year long!

GIULIANA RANCIC

LILY COLLINS

  • rosewood pink floral Zuhair Murad gown adorned with cape and showered with beads

EMMA STONE

PRIYANKA CHOPRA

CHRISSY TIEGEN

  • Marchesa metallic lace fishtail gown with halter neck, sculptural peplum, and floral embroidery from the recent Spring 2016 line
  • Jimmy Choo Carmen clutch
  • Lorraine Schwartz jewelry

KRISTIN CAVALLARI

OLIVIA CULPO

GINA RODRIGUEZ

SOFIA VERGARA

KELLY PRESTON

BRIE LARSON

AMY ADAMS

  • Tom Ford anthracite sequin strapless gown
  • sparkly Cartier earrings and bracelet

THANDIE NEWTON

MILLIE BOBBY BROWN

FELICITY HUFFMAN

TRACE LYSETTE

JANELLE MONAE

LOLA KIRKE

JESSICA CHASTAIN

Sistine, Scarlet, and Sophie Stallone

BLAKE LIVELY & RYAN REYNOLDS

For Ryan…

JUSTIN TIMBERLAKE

 

2016 Emmys — Best Dressed

Took a bit longer to get this Best Dressed list out than usual. But of course, I had to do one for the 2016 Emmy Awards. Here are my faves —

KRISTEN BELL

kristen-bell-emmys-red-carpet-2016__opt

SARAH PAULSON

image

Makeup artist Adam Breuchaud emphasized Paulson’s created a metallic eye look using Eye Tint in Cold Copper topped with Eyes to Kill Intense Eyeshadow in #6, both by Giorgio Armani.

gallery-1474248916-sarah-paulson

NEVE CAMPBELL

rs_634x1024-160918163150-634-neve-campbell-cm-91816

neve-campbell-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

CONNIE BRITTON

68th Annual Primetime Emmy Awards - Arrivals

ALLISON JANNEY

Allison Janney

MEGALYN ECHIKUNWOKE

ima1ge

EMILY RATAJKOWSKI

emily-ratajkowski-best-dressed-emmys-2016

Makeup artist Hung Vanngo re-imagined the classic cat eye in iris-brightening jewel-tones. To get the look, try Line PRO Eye Pencil in Navy and Aqua, both by Lorac.

gallery-1474241458-emrata

CARLY CHAIKIN

gettyimages-607576856_master

ABIGAIL SPENCER

2016-emmys-abigail-spencer

EMILY ROBINSON

emily-robinson-68th-annual-emmy-awards-in-los-angeles-09-18-2016-3

SHIRI APPLEBY

2016-%20emmys-shiri-appleby

HOLLY TAYLOR

holly-taylor-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

holly-taylor-68th-annual-emmy-awards-in-los-angeles-09-18-2016-1_thumbnail

PADMA LAKSHMI

68th Annual Primetime Emmy Awards - Arrivals

im2age

Makeup artist Patrick Ta proves that fuchsia lips are more than a summer staple. To get the look he mixed two shades of Kat Von D Everlasting Liquid Lipsticks, bright lavender and hot pink.

gallery-1474247064-padma-lakshmi

NANCY O’DELL

a_4x-vertical

LARA SPENCER

68thannualprimetimeemmyawardsarrivalsk-kn3vs_p02x

FELICITY HUFFMAN & WILLIAM H. MACY

William H. Macy, Felicity Huffman

Felicity is wearing a stunning Tony Ward lace gown.

2016-emmys-felicity-huffman

TERRENCE HOWARD & MIRA PAK

gettyimages-607627800_master

MARIO LOPEZ

52588_mario-lopez-alfombra-roja-emmy-2016

ZAC POSEN

68th Annual Primetime Emmy Awards - Arrivals