Met Gala 2017 — Best of the Best

Each year, the Metropolitan Museum of Art puts on an annual Costume Institute exhibit and this year’s exhibit focuses on designer Rei Kawakubo, Comme des Garçons, and “the art of the in-between.” It pays tribute to Rei Kawakubo, the legendary designer behind Commes Des Garçons. Kawakubo is known for her risk-taking, out-of-the-box aesthetic, and attendees channeled that with a stream of crazed beauty looks and extreme gowns/dresses. Here are my top pics!

BLAKE LIVELY

EMILY RATAJKOWSKI

BRIE LARSON

Larson’s hairstylist Mara Roszak misted her hair with L’Oréal Paris Advanced Hairstyle Sleek It Strand Smoother Serum-Spray for the intense shine.

HALLE BERRY

SOPHIE TURNER

  • a white-and-silver lace Louis Vuitton gown with gold panels on the bodice

ANNA WINTOUR

SELENA GOMEZ

  • makeup artist Hung Vanngo — one of the most eye-catching makeup looks of the evening: An electrifying, hot pink smoky eye created by makeup artist Hugo Vanngo. “The twist was the bright pink Marc Jacobs Beauty eyeliner I came across while sorting through colors”
  • Tiffany & Co.
  • cream Coach gown

KYLIE JENNER

CASSIE

KERRY WASHINGTON

RILEY KEOUGH

BEE SHAFFER

REESE WITHERSPOON

KRISTIN CAVALLARI

FELICITY JONES

  • a periwinkle Old West-inspired custom Erdem gown with a bustle, ruffles and high neck

LILY COLLINS

a base of Lancôme Le Crayon Khol in Black Ebony (yep, that’s an eyeliner) then layer Lancôme L’Absolu Rouge Lipstick in 397 Berry Noir on top. (makeup by Fiona Stiles)

FRANCES BEAN

LALA ANTHONY

ZENDAYA

HAILEY BALDWIN

KATIE HOLMES

  • deep teal off-the-shoulder Zac Posen

NICK JONAS

  • jacquard tux and smoking slippers by Ralph Lauren Purple Label

 

Other Fave Oscars Related Looks

The Oscars is not all about the main red carpet, there is the Vanity Fair afterparty, the Elton John AIDS Foundation party (aka the Oscars viewing party), The Weinstein Co. afterparty, and the Independent Spirit Awards, all part of the Oscars weekend. What does this mean? There are so many more looks to fall in love with and here are my top picks!

KATE BOSWORTH

HAILEE STEINFELD

EMMA ROBERTS

SAVANNAH CHRISLEY

KATE HUDSON

SOFIA VERGARA

HEIDI KLUM

DEMI LOVATO

PETRA NEMCOVA

LEONA LEWIS

PORTIA DOUBLEDAY

LILY COLLINS

NINA AGDAL

THANDIE NEWTON

EMILY RATAJKOWSKI

RASHIDA JONES

ROSIE HUNTINGTON-WHITELEY

FELICITY JONES

  • a dark eggplant sequin short-sleeve Erdem gown with floral motif

NAOMIE HARRIS

2017 Oscars — Best Dressed

I guess it is safe to say that nude-toned gowns, or ones with sheer effects most caught my eye! Here is the best of the best though in my book!

HAILEE STEINFELD

  • Ralph & Russo gown with ruffle neckline and watercolor floral print with metallic details
  • Neil Lane jewelry, total value in fact $750K, including a 10-carat diamond-and-platinum studs, a 10-carat diamond-and-platinum line bracelet and a 25-carat oval link diamond-and-platinum bracelet worth $250,000.
  • smoky eye by makeup artist Mary Phillips
  • use of Essie nail polish

SOFIA CARSON

EMMA STONE

EMMA ROBERTS

NICOLE KIDMAN

  • custom pale apricot Armani Privé gown with arabesque embroidery
  • nude Stuart Weitzman heels
  • Harry Winston jewelry, total Carat count, 119 — including 30.60-carat cluster diamond-and-spinel drop earrings (valued at $235,000), 44.03-carat vintage cluster diamond bracelet, a 31.59-carat splash diamond bracelet and 13.58-carat pear-shaped diamond ring
  • Omega watch

In an exciting swap from her usual nude lip, Nicole Kidman went for a bold, crimson hue that makeup artist Jeanine Lobell creating using Giorgio Armani lipstick in #402, followed by a dab of Neutrogena Hydro Boost Hydrating Lip Shine in Deep Cherry.

HALLE BERRY

GEORGINA CHAPMAN

SARA BAREILLES

CHRISSY TEIGEN

ROBIN ROBERTS

JESSICA OYELOWO

ZURI HALL

ROSALIND ROSS

Mel looks okay too!

CHRIS EVANS

 

2017 Grammy Awards — Best Dressed

Lots to see from the 2017 Grammy Awards, but also the 2017 BAFTAs. Here are my faves —

CAMILA CABELLO

KELSEA BALLERINI

LAUREN DAIGLE

KATHARINE MCPHEE

KRISTIN CAVALLARI

JANE ZHANG

HILARY SCOTT

LITTLE BIG TOWN

ENYA

BROOKLYN & BAILEY MCKNIGHT

  • Trying out the So Lashy Mascara by CoverGirl

KRIS JENNER

JULIA STILES

PRINCE WILLIAM & KATE

EMILY BLUNT & JOHN KRASINSKI

EDDIE REDMAYNE & wife HANNAH BAGSHAWE

CARMEN EJOGO

  • Emanuel Ungaro gown

Globes AfterParties — Best of the Best

The Golden Globes main red carpet was phenomenal, but so too were the various looks from the whole Golden Globes weekend, the Art of Elysium Gala, W Mag’s It Girl luncheon, and afterparties from HBO, InStyle & Warner Bros., and Netflix. Enjoy!

Angela Sarafyan

Lucy Hale

Nikki Reed

Naomie Harris

Maya Henry

Constance Wu

Sophia Bush

Kristen Bell

Amanda Crew

Jenna Dewan-Tatum

Halston Sage

Zoey Deutch

Mandy Moore

Vanessa Hudgens

Lisa Rinna

Shanina Shaik

Hailey Baldwin

Caitriona Balfe

 

Golden Globes 2017 — Best Dressed

At the end of 2016, I had such joy in looking back at all of the red carpets throughout the year. So it seems only fitting that one of my first posts of the new year is a best dressed list, the 2017 Golden Globes Awards to be precise. I think some of these looks will be remembered all year long!

GIULIANA RANCIC

LILY COLLINS

  • rosewood pink floral Zuhair Murad gown adorned with cape and showered with beads

EMMA STONE

PRIYANKA CHOPRA

CHRISSY TIEGEN

  • Marchesa metallic lace fishtail gown with halter neck, sculptural peplum, and floral embroidery from the recent Spring 2016 line
  • Jimmy Choo Carmen clutch
  • Lorraine Schwartz jewelry

KRISTIN CAVALLARI

OLIVIA CULPO

GINA RODRIGUEZ

SOFIA VERGARA

KELLY PRESTON

BRIE LARSON

AMY ADAMS

  • Tom Ford anthracite sequin strapless gown
  • sparkly Cartier earrings and bracelet

THANDIE NEWTON

MILLIE BOBBY BROWN

FELICITY HUFFMAN

TRACE LYSETTE

JANELLE MONAE

LOLA KIRKE

JESSICA CHASTAIN

Sistine, Scarlet, and Sophie Stallone

BLAKE LIVELY & RYAN REYNOLDS

For Ryan…

JUSTIN TIMBERLAKE

 

2016 Emmys — Best Dressed

Took a bit longer to get this Best Dressed list out than usual. But of course, I had to do one for the 2016 Emmy Awards. Here are my faves —

KRISTEN BELL

kristen-bell-emmys-red-carpet-2016__opt

SARAH PAULSON

image

Makeup artist Adam Breuchaud emphasized Paulson’s created a metallic eye look using Eye Tint in Cold Copper topped with Eyes to Kill Intense Eyeshadow in #6, both by Giorgio Armani.

gallery-1474248916-sarah-paulson

NEVE CAMPBELL

rs_634x1024-160918163150-634-neve-campbell-cm-91816

neve-campbell-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

CONNIE BRITTON

68th Annual Primetime Emmy Awards - Arrivals

ALLISON JANNEY

Allison Janney

MEGALYN ECHIKUNWOKE

ima1ge

EMILY RATAJKOWSKI

emily-ratajkowski-best-dressed-emmys-2016

Makeup artist Hung Vanngo re-imagined the classic cat eye in iris-brightening jewel-tones. To get the look, try Line PRO Eye Pencil in Navy and Aqua, both by Lorac.

gallery-1474241458-emrata

CARLY CHAIKIN

gettyimages-607576856_master

ABIGAIL SPENCER

2016-emmys-abigail-spencer

EMILY ROBINSON

emily-robinson-68th-annual-emmy-awards-in-los-angeles-09-18-2016-3

SHIRI APPLEBY

2016-%20emmys-shiri-appleby

HOLLY TAYLOR

holly-taylor-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

holly-taylor-68th-annual-emmy-awards-in-los-angeles-09-18-2016-1_thumbnail

PADMA LAKSHMI

68th Annual Primetime Emmy Awards - Arrivals

im2age

Makeup artist Patrick Ta proves that fuchsia lips are more than a summer staple. To get the look he mixed two shades of Kat Von D Everlasting Liquid Lipsticks, bright lavender and hot pink.

gallery-1474247064-padma-lakshmi

NANCY O’DELL

a_4x-vertical

LARA SPENCER

68thannualprimetimeemmyawardsarrivalsk-kn3vs_p02x

FELICITY HUFFMAN & WILLIAM H. MACY

William H. Macy, Felicity Huffman

Felicity is wearing a stunning Tony Ward lace gown.

2016-emmys-felicity-huffman

TERRENCE HOWARD & MIRA PAK

gettyimages-607627800_master

MARIO LOPEZ

52588_mario-lopez-alfombra-roja-emmy-2016

ZAC POSEN

68th Annual Primetime Emmy Awards - Arrivals

2016 VMAs — Best Dressed

Not the longest lists, but there certainly are some pretty hot numbers for this year’s white aka red carpet. Enjoy!

NICKI MINAJ

2016-vmas-nicki-minaj

HEIDI KLUM

2016 MTV Video Music Awards - Red Carpet

mtv-vma-red-carpet-2016-heidi-klum

FIFTH HARMONY

gallery-1472427859-gettyimages-597195186

All wearing —

Final 4 of 5 USA Women’s Gymnastics Team

2016 MTV Video Music Awards - Red Carpet

mtv-vma-red-carpet-2016-simone-biles-aly-raisman

HAILEY BALDWIN

mtv-vma-red-carpet-2016-hailey-baldwin

TAYLOR HILL

2016-vmas-taylor-hill

HAILEE STEINFELD

2016-vmas-hailee-steinfeld

mtv-vma-2016-beauty-looks-hailee-steinfeld

SHELLEY HENNIG

2016-vmas-shelley-hennig

JAY PHAROAH

2016-vmas-jay-pharoah

Best Dressed of Cannes 2016

A film festival event like no other — the 2016 Cannes!! But as any true fashionista knows, this wonderful film event is truly very big in the fashion realm as well. It produces so much stunning fashion that I had to devote 2 features to showcase it all! Here is Part One!

ANYTHING BLAKE LIVELY WORE!!

The BFG Screening During the 69th Cannes Film Festival

Blake is at the premiere of BFG.

blake-lively-9

At the Slack Bay (Ma Loute) premiere.

13254613_949491691834485_4035010384604918674_n

blake-lively-blue

  • for various looks, including this one above, Rod Ortega for hair

'Cafe Society' premiere and opening ceremony, 69th Cannes Film Festival, France - 11 May 2016

At the premiere of Cafe Society

  • again, wearing a gorgeous, sparkling Versace gown

May 13, 2016 - Celebrity Sightings At The 69th Annual Cannes Film Festival

blake-lively-4

at a CAFÉ SOCIETY EVENT

blake-lively-1

KENDALL JENNER

gettyimages-531595784

At the From the Land and the Moon premiere.

  • Roberto Cavalli gown, long t-shirt dress in silk tulle all-over embroidery with black velvet and gold lurex snakes intertwined.
  • Chopard earrings — 43 carats of diamonds
  • black Gianvito Rossi heels

kendall-jenner

Magnum Doubles Party - Red Carpet Arrivals - The 69th Annual Cannes Film Festival

MISCHA BARTON

gettyimages-531746172_master

At the Loving premiere.

amfAR's 23rd Cinema Against AIDS Gala, Cocktail Reception, Cannes, France - 19 May 2016

GEORGINA CHAPMAN

georgina-chapman-gettyimages-531754894_master_article_gallery_portrait

Hands of Stone premiere

JESSICA CHASTAIN

gettyimages-531015372_master

At the premiere of Money Monster.

jessica-chastain-a-660

NAOMI WATTS

naomi-watts-gettyimages-530689932

at the opening ceremony premiere of Café Society.

KRISTEN DUNST

"Loving" - Red Carpet Arrivals - The 69th Annual Cannes Film Festival

In Dior Haute Couture at the Loving premiere.

  • white Dior gown with lily of the valley embroidery on the straps and bodice
  • pop of Rouge Dior Brillant Red 999 on her lips

Closing ceremony of the 69th Annual Cannes Film Festival

Chopard jewelry to the festival’s Closing Ceremony.

gallery-1462989019-gettyimages-530597346

  • Gucci gown with bright red rose floral prints

Kering And Cannes Film Festival Official Dinner : Photocall At The 69th Cannes Film Festival

SONAM KAPOOR

gettyimages-531593540

gettyimages-531746028_master

At the Loving premiere

BELLA HADID

gettyimages-530558942_master

At the opening ceremony premiere of Café Society

 MALLIKA SHERAWAT

mallika-sherawat-gettyimages-530674568

at the Opening ceremony for Cafe Society

CHARLIZE THERON

MTM4NTkxNzM0NTA1NDE2MTAz

At La Chateau de la Colle Noire wearing Dior

LOTTIE MOSS

Chopard Party - Red Carpet Arrivals - The 69th Annual Cannes Film Festival - The 69th Annual Cannes Film Festival

CHERYL COLE

gettyimages-531221584_master

At the Slack Bay (Ma Loute) premiere

 

Met Gala 2016 — Best of the Best

FINALLLLLLYYYYYYYY getting around to putting out my Best Dressed list from the 2016 Met Gala. As stunning as some of these looks were, I definitely couldn’t overlook this feature!

KAROLINA KURKOVA

this-celebrity-wore-the-met-galas-first-ever-cognitive-dress

CLAIRE DANES

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

13117842_218555531859786_1769143866_n

POPPY DELEVIGNE

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

MTM4Mzk0MzQ5MDgyNzgwOTk3

ZOEY DEUTCH

160503-08-477x735

zoey-deutch-ellie-bamber-met-gala-02

zoey-deutch-00

KATE HUDSON

kate-hudson-met-gala-2016-red-carpet

kate-hudson-met-gala-drugstore-nails-

ZOE SALDANA

zoe-saldana-600x450

RACHEL MCADAMS

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

MTM4Mzk0MzQ5NjE5NzgyOTgy

NINA DOBREV

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

DrielyS-8968

nina-dobrev-gettyimages-527423324_master_v1000x1500

RITA ORA

The Metropolitan Museum of Art's COSTUME INSTITUTE Benefit Celebrating the Opening of Manus x Machina: Fashion in an Age of Technology, Arrivals, The Metropolitan Museum of Art, NYC, New York, America - 02 May 2016

Copy what celebrity makeup artist Kathy Jeung did: Blend a bronze shade across your lid. Then apply Rimmel London ScandalEyes Waterproof Eyeshadow Stick in Witness White to the inside corners of your eyes, and blend that out with the Guilty Grey

rita-ora-met-gala-drugstore-beauty

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

HAIM

haim

WENDI DENG

33C0BCBA00000578-0-Wendi_Deng_stunned_at_New_York_s_Met_Gala_in_one_of_the_few_publ-m-91_1462250117152

EMMA ROBERTS

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

DrielyS-8882-1542x1027

KYLIE JENNER

Jen Atkin, who zhuzzed up the wig created by Tokyo Stylez. Atkin blew the look straight using the Dyson blowdryer and a round brush, before she finished it with a flatiron, Christophe Robin brightening hair finishing lotion for shine, and Ouai Soft Hair Spray for hold.

kylie-jenner-met-gala-2016-red-carpet

BLAKE LIVELY

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

hair-blake-lively

blake-lively-met-gala-2016-red-carpet

JOURDAN DUNN

The model matched her Balmain dress with a brilliant silvery smoky eye, crafted from a mix of two Maybelline New York Eye Studio 24HR Color Tattoo Cream Gel Shadows ($7 each). Makeup artist Hila Karmand first applied the Audacious Asphalt color all over Jourdan’s lid as a base. Then she added Silver Strike to the inner corners of her eyes. After that, to really smoke out the shadows and lock the creams in place, Karmand used the light silver shade in the Maybelline New York The Rock Nudes Palette($10) on the upper lid. Then from the outer corner, she applied the glittery charcoal color (also from the palette) and blended it over the silver until it created a gradient effect. Underneath the lower lash line, she used a pointy pencil brush to blend a gray shadow with black liner.

13126836_1161294587228362_1376584315_n

jourdan-dunn-met-gala-drugstore-beauty

KARLIE KLOSS

A classic red lip and thick, voluminous lashes work for any occasion—even one where people show up dressed in light-up Cinderella dressesand wolverine contacts, as Karlie proves here. To get the look, L’Oréal Paris celebrity makeup artist Sir John swept two coats of L’Oréal Paris Voluminous Superstar Red Carpet Mascara ($11) over individually applied false lashes. And for her lips, he applied two coats of L’Oréal Paris Infallible Pro-Matte Gloss in Rouge Envy ($10), tapping on a little translucent powder to set the color, and finishing with one last swipe.

karlie-kloss-met-gala-drugstore-beauty-2

ALEX MORGAN

Alex-Morgan

CINDY CRAWFORD

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

ALESSANDRA AMBROSIO

The Metropolitan Museum of Art's COSTUME INSTITUTE Benefit Celebrating the Opening of Manus x Machina: Fashion in an Age of Technology, Arrivals, The Metropolitan Museum of Art, NYC, New York, America - 02 May 2016

ELIZABETH CORDRY

elizabeth-cordry-met-gala-2016-red-carpet

BEE SHAFFER

the-met-gala-red-carpet-looks-everyone-is-talking-about-1754603-1462228190.640x0c

JENNIFER HUDSON

"Manus x Machina: Fashion In An Age Of Technology" Costume Institute Gala - Arrivals

MILES TELLER & KELEIGH SPERRY

Celebrities+Head+MET+Costume+Institute+Gala+R1Kl7SMzafsl

DrielyS-9512