Other Fave Oscars Related Looks

The Oscars is not all about the main red carpet, there is the Vanity Fair afterparty, the Elton John AIDS Foundation party (aka the Oscars viewing party), The Weinstein Co. afterparty, and the Independent Spirit Awards, all part of the Oscars weekend. What does this mean? There are so many more looks to fall in love with and here are my top picks!

KATE BOSWORTH

HAILEE STEINFELD

EMMA ROBERTS

SAVANNAH CHRISLEY

KATE HUDSON

SOFIA VERGARA

HEIDI KLUM

DEMI LOVATO

PETRA NEMCOVA

LEONA LEWIS

PORTIA DOUBLEDAY

LILY COLLINS

NINA AGDAL

THANDIE NEWTON

EMILY RATAJKOWSKI

RASHIDA JONES

ROSIE HUNTINGTON-WHITELEY

FELICITY JONES

  • a dark eggplant sequin short-sleeve Erdem gown with floral motif

NAOMIE HARRIS

2016 Emmys — Best Dressed

Took a bit longer to get this Best Dressed list out than usual. But of course, I had to do one for the 2016 Emmy Awards. Here are my faves —

KRISTEN BELL

kristen-bell-emmys-red-carpet-2016__opt

SARAH PAULSON

image

Makeup artist Adam Breuchaud emphasized Paulson’s created a metallic eye look using Eye Tint in Cold Copper topped with Eyes to Kill Intense Eyeshadow in #6, both by Giorgio Armani.

gallery-1474248916-sarah-paulson

NEVE CAMPBELL

rs_634x1024-160918163150-634-neve-campbell-cm-91816

neve-campbell-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

CONNIE BRITTON

68th Annual Primetime Emmy Awards - Arrivals

ALLISON JANNEY

Allison Janney

MEGALYN ECHIKUNWOKE

ima1ge

EMILY RATAJKOWSKI

emily-ratajkowski-best-dressed-emmys-2016

Makeup artist Hung Vanngo re-imagined the classic cat eye in iris-brightening jewel-tones. To get the look, try Line PRO Eye Pencil in Navy and Aqua, both by Lorac.

gallery-1474241458-emrata

CARLY CHAIKIN

gettyimages-607576856_master

ABIGAIL SPENCER

2016-emmys-abigail-spencer

EMILY ROBINSON

emily-robinson-68th-annual-emmy-awards-in-los-angeles-09-18-2016-3

SHIRI APPLEBY

2016-%20emmys-shiri-appleby

HOLLY TAYLOR

holly-taylor-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

holly-taylor-68th-annual-emmy-awards-in-los-angeles-09-18-2016-1_thumbnail

PADMA LAKSHMI

68th Annual Primetime Emmy Awards - Arrivals

im2age

Makeup artist Patrick Ta proves that fuchsia lips are more than a summer staple. To get the look he mixed two shades of Kat Von D Everlasting Liquid Lipsticks, bright lavender and hot pink.

gallery-1474247064-padma-lakshmi

NANCY O’DELL

a_4x-vertical

LARA SPENCER

68thannualprimetimeemmyawardsarrivalsk-kn3vs_p02x

FELICITY HUFFMAN & WILLIAM H. MACY

William H. Macy, Felicity Huffman

Felicity is wearing a stunning Tony Ward lace gown.

2016-emmys-felicity-huffman

TERRENCE HOWARD & MIRA PAK

gettyimages-607627800_master

MARIO LOPEZ

52588_mario-lopez-alfombra-roja-emmy-2016

ZAC POSEN

68th Annual Primetime Emmy Awards - Arrivals

Best Dressed of Cannes 2016

A film festival event like no other — the 2016 Cannes!! But as any true fashionista knows, this wonderful film event is truly very big in the fashion realm as well. It produces so much stunning fashion that I had to devote 2 features to showcase it all! Here is Part One!

ANYTHING BLAKE LIVELY WORE!!

The BFG Screening During the 69th Cannes Film Festival

Blake is at the premiere of BFG.

blake-lively-9

At the Slack Bay (Ma Loute) premiere.

13254613_949491691834485_4035010384604918674_n

blake-lively-blue

  • for various looks, including this one above, Rod Ortega for hair

'Cafe Society' premiere and opening ceremony, 69th Cannes Film Festival, France - 11 May 2016

At the premiere of Cafe Society

  • again, wearing a gorgeous, sparkling Versace gown

May 13, 2016 - Celebrity Sightings At The 69th Annual Cannes Film Festival

blake-lively-4

at a CAFÉ SOCIETY EVENT

blake-lively-1

KENDALL JENNER

gettyimages-531595784

At the From the Land and the Moon premiere.

  • Roberto Cavalli gown, long t-shirt dress in silk tulle all-over embroidery with black velvet and gold lurex snakes intertwined.
  • Chopard earrings — 43 carats of diamonds
  • black Gianvito Rossi heels

kendall-jenner

Magnum Doubles Party - Red Carpet Arrivals - The 69th Annual Cannes Film Festival

MISCHA BARTON

gettyimages-531746172_master

At the Loving premiere.

amfAR's 23rd Cinema Against AIDS Gala, Cocktail Reception, Cannes, France - 19 May 2016

GEORGINA CHAPMAN

georgina-chapman-gettyimages-531754894_master_article_gallery_portrait

Hands of Stone premiere

JESSICA CHASTAIN

gettyimages-531015372_master

At the premiere of Money Monster.

jessica-chastain-a-660

NAOMI WATTS

naomi-watts-gettyimages-530689932

at the opening ceremony premiere of Café Society.

KRISTEN DUNST

"Loving" - Red Carpet Arrivals - The 69th Annual Cannes Film Festival

In Dior Haute Couture at the Loving premiere.

  • white Dior gown with lily of the valley embroidery on the straps and bodice
  • pop of Rouge Dior Brillant Red 999 on her lips

Closing ceremony of the 69th Annual Cannes Film Festival

Chopard jewelry to the festival’s Closing Ceremony.

gallery-1462989019-gettyimages-530597346

  • Gucci gown with bright red rose floral prints

Kering And Cannes Film Festival Official Dinner : Photocall At The 69th Cannes Film Festival

SONAM KAPOOR

gettyimages-531593540

gettyimages-531746028_master

At the Loving premiere

BELLA HADID

gettyimages-530558942_master

At the opening ceremony premiere of Café Society

 MALLIKA SHERAWAT

mallika-sherawat-gettyimages-530674568

at the Opening ceremony for Cafe Society

CHARLIZE THERON

MTM4NTkxNzM0NTA1NDE2MTAz

At La Chateau de la Colle Noire wearing Dior

LOTTIE MOSS

Chopard Party - Red Carpet Arrivals - The 69th Annual Cannes Film Festival - The 69th Annual Cannes Film Festival

CHERYL COLE

gettyimages-531221584_master

At the Slack Bay (Ma Loute) premiere

 

MTV Movie Awards 2015 — Best Dressed

Always a fun and exhilarating red carpet, the MTV Movie Awards. Here is my Best Dressed list, as well as an honorable mention from the 2015 Olivier Awards.

Sofia Vergara

1428888270_sofia-vergara-560

Not enough words to express how much I love Sofia’s look here, a cobalt blue Noam Hanoch dress with lace cutouts. What a stand-out dress — the color, the lace, so chic and sexy!

jennifer-lopez-black-suit-mtv-movie-awards-2015-h724

Jennifer Lopez

J. Lo is rockin’ these red carpets lately, always looking so amazingly captivating! Here she is donning a Anthony Vaccarello x Versus Versace suit jacket, mini skirt, and belt. Accessorizing just as well, she has paired with her look gold Chimento and Vita Fede jewels, a black and gold Salvatore Ferragamo clutch and coordinating Giuseppe Zanotti heels.

Anna Camp
1428882267_anna-camp-560

This multi-colored and printed Peter Pilotto dress is a great choice for Anna; it’s so lively and vibrant! She coordinated well with her accessories — sky blue Stuart Weitzman heels and jewelry from both Shylee Rose and EF Collection.

Her beauty look, a sunkist, fresh take, was courtesy of Melanie Inglessis. Gorgeous flowy waves were by Rob Talty. The overall look was put together by Jessica Paster.

brittany-snow-anna-camp-mtv-movie-awards-2015-04

1428886492_maia-mitchell-560

Maia Mitchell

Maia clearly believes there is nothing wrong with a basic LBD and I couldn’t agree more! This fitted, long-sleeved Reiss dress looks great on her, just an overall simplistically minimal look with Tory Burch heels to top it all off!

Katie Stevens

2015+MTV+Movie+Awards+Arrivals+1y82JIRfDpzl

I’ve been a fan of Katie since her days on Idol and I love her current hit MTV show Faking It. So glad to see her doing well and looking so great! She looks phenomenal in this short-sleeved white Rachel Zoe frock with gold bead embellishments on both the hem and sleeves.

Completing her look are some just as stunning accessories — nude Stuart Weitzman heels, white and rose pink Tyler Alexandra clutch, and understated Ruifier jewels.

Victoria Justice

1428882195_victoria-justice-560

There is just something about this fun and flirty Versace look that keeps catching my eye and attention. I’m not sure if it’s the cutouts or the color palette, but I absolutely love it! It’s completely adorned with Swarovski crystals and she is even accessorizing with some Swarovski jewelry as well. Completing her look are black Jimmy Choos.

11017875_10153357346960832_5640598588645330396_n

Emily Ratajkowski

1428882349_emily-ratajkowski-560

There is just no doubt this is a super sexy, crazy cool dress by Fausto Puglisi. The embellished partial bodice is very mesmerizing and it’s in a great color, bright green! Emily accessorized with Jennifer Meyer jewelry, Eva Fehren earrings, and a Borgioni ring, as well as a black Amanda Pearl clutch.

Bridget Regan

2015+MTV+Movie+Awards+Arrivals+QhMbJQHUslml

Bridget was a little matchy-matchy with the blue carpet, but this look, with the hand-painted details, was so gorgeous, what a stunner! Her stylist Karen Raphael picked a truly great look here by Elena Reva. She paired with this dress metallic heels from Via Spiga.

2015+MTV+Movie+Awards+Arrivals+uPbzi-4FXaLl

Bailey De Young

Bailey looked fun, flirty, prim, proper and cute in this Alice and Olivia skirt and top. The pairing of the floral top with the bright cobalt blue skirt was a great styling choice. She coordinated with her look a Per Lo Jewelry bracelet.

Vanessa Marano

2015+MTV+Movie+Awards+Red+Carpet+TGabclKx5vEl

Vanessa looked chic and fab here in this color-blocked Jay Godfrey dress. She left no detail unnoticed and accessorized well with a glittery silver Rauwolf clutch, Ruifier ring, and white Lust for life heels.

Miles Teller

The 2015 MTV Movie Awards - Arrivals

The only designer detail I know for Miles looks is that his timepiece is Montblanc. But I just love this casually stylish separates look; he looks great!

Nicole Scherzinger

And for my honorable mention, the 2015 Olivier Awards, sponsored my MasterCard, we have Nicole. The awards show is basically London’s version of the Tony Awards.

Olivier+Awards+Red+Carpet+Arrivals+oZ9m87Ia69Gl

This is an elegant black look, very fashionable and glamorous for the red carpet at hand, just very much a smashing success of a look!

2015 Golden Globes — Best Dressed

Ahhhhh! The much anticipated 2015 Golden Globes aired last night on NBC, filmed at the extravagant Beverly Hilton Hotel. And needless to say, the show was great. But also, and no surprise here, the red carpet was PHENOMENAL!! It seemed quite a few trends were very ever-present on the red carpet, one such being bold, bright red gowns. Red gowns also ruled my own Best Dressed list, as well as almost every Versace gown too!

There were so many gowns that I adored. It was hard to narrow down, so actually I didn’t! Just kidding! My list isn’t terribly long considering the vast amount of dresses donned by these major celebrities, but I did have to add a few extra to my list because there were just so many amazing looks to choose from. So here we go —

011115-GG-greer-grammer-428

GREER GRAMMER

Greer, aka Miss Golden Globes 2015, looked like a beautiful princess in this blush Lorena Sarbu gown with gold floral embellishments. She was definitely captivating on both the red carpet and the awards stage.

72nd Annual Golden Globe Awards - Arrivals

Her look was completed with some statement-making Neil Lane jewelry, including her bold dangling earrings, and then a shimmery gold Jimmy Choo clutch. Her stunning beauty look, created by Kip Zachary, encompassed a light blush on the cheek & pretty rose lip, compliments of L’Oreal Paris. All in all, styled by Kelly Johnson.

72nd Annual Golden Globe Awards - Arrivals

KATE HUDSON

Kate Hudson

There was no denying how gorgeous Kate looked in this severely sexy white Versace gown. Everything about this dress was perfection — the slight train, the amazing fit, & the intricate detailed cutouts at the sides.

kate-hudson-shows-tons-of-skin-at-golden-globes-2015-02

Makeup artist Christian McCulloch calls Hudson the “ultimate golden California goddess” and opted for varying shades of tan, bronze, and gold from Dolce & Gabbana’s makeup line to complement her stunning white Atelier Versace gown.

She added some sparkle to her look with some beautiful diamond pieces from Forevermark.

Colorist Cassondra Keeding added babylights to Hudson’s blond strands to further emphasize the sun-goddess effect, while ghd Brand Ambassador, David Babaii, created a modern day chignon using the ghd Eclipse Flat Iron.

kate-hudson-shows-tons-of-skin-at-golden-globes-2015-03

And finally, showcasing how captivating this look is from every angle, the backside is superbly stunning. The details at the side are embellished with Swarovski crystals. Also, to coordinate well with her white & silver look is a white Jimmy Choo clutch.

kate-hudson-golden-globes-instagram

Heidi Klum  HEIDI KLUM

Va va voom! Heidi is smokin’ in this one-shoulder red Versace gown. Perfectly coordinating are her custom red Jimmy Choo “Jane” sandal heels.

72nd Annual Golden Globe Awards - ArrivalsLorraine Schwartz always knows how to add that right amount of sparkle, and does so well to complete Heidi’s A+ look with diamond earrings and rings.

Heidi Klum arrives at the 72nd Golden Globe Awards in Beverly Hills

Heidi’s styling team has done a fantastic job here — Linda Hay for makeup, creating a daring beauty look with a bold red lip; Christian Wood for hair, with this effortlessly elegant curly side-swept do; Tom Bachik for these lovely clear nails; & of course, this all couldn’t have been accomplished without Heidi’s talented stylist, Maryam Malakpour.

heidi-klum-@heidiklumANNA KENDRICK

72nd Annual Golden Globe Awards - Arrivals

Still channeling her Cinderella character from Anna’s recent starring role with Into the Woods, she is looking very fairy tale-esque in this nude Monque Lhuillier gown with ruby beaded embellishments.

3305e349a04d4fccd513ded9ef7c27a7752f9000She was very smart to add these matching ruby red Fred Leighton earrings to top off her immaculate look.

Kendrick showed up on the red carpet looking like the movie star she is — a clean, elegant updo and highlighted, beautiful skin are all she needed to show off her true, effortless beauty. Makeup artist Vanessa Scali dusted Dolce & Gabbana’s Illuminator in Eva on the cheekbones, browbones, and down the nose to give the actress her ethereal glow.

anna-kendrick-600x450With regard to her elegant updo, the creator was Craig Gangi. And here are all of the fun details! “Anna’s dress was whimsical and fairytale-esque,” Gangi tells PEOPLE. “So to offset the dress, we decided to create a sleek, modern and sophisticated tight chignon for an elegant ballerina chic style.” To create the look, Gangi began applying his favorite “go-to product” — Bumble and bumble Hairdresser’s Invisible Oil — to the star’s damp hair. “It magically helped me transform Anna’s naturally curly hair into a silky smooth blowout,” he says. Once he finished blowing out Kendrick’s strands (using the Bumble and bumble Round Brush), Gangi used a flat iron to straighten it and sprayed each section with Bumble and bumble Does It All Styling Spray to “lock locks into a perfectly straight but fresh and bouncy look.”

anna-kendrick-600x800After spraying down her hair, Gangi parted it down the middle and brushed it into a tight, low pony before curling it using a 1-1/2 inch curling iron. As soon as her hair cooled, he brushed out curl and braided a small section and twisted it into a bun and pinned it in place. To complete the look, Gangi says he “wrapped the braid around the bun and pinned with a few strategically placed bobby pins to secure.”

The finishing touch? A good hairspray of course. “I used Bumble and bumble Spray de Mode Hairspray to lock style in place.”

72nd Annual Golden Globe Awards - Arrivals

Amy Adams

AMY ADAMS

Amy was a vision in this perfectly draped, one-shoulder, periwinkle Versace gown. And yes, I do believe every person who donned Versace made by list so stay tuned to keep seeing Versace on it! Versace was definitely the awarding winning designer brand for Fashion Nexus! She wonderfully completed her look with matching Jimmy Choo heels & a few diamond Tiffany & Co. pieces.

00638b97b98fee93ddc97a418bcbba0ebd5698ea

As part of her beauty look, Adams donned a trend of the night, retro waves. She channeled Jessica Rabbit (only fitting with red locks like hers), with loose, romantic waves swept to the side for added impact. Hairstylist Laini Reeves achieved the look with Oribe’s Volumista applied damp hair from roots to ends. After blowing hair dry, she used a two-inch curling iron and rollers to pin-curl hair up in four sections. She sprayed the style with Oribe’s Shine Light Reflecting Spray and let it sit for 20 minutes before removing pins and rollers and brushing hair out with a Mason Pearson brush to create the softness.

ANNA FARIS

72nd Annual Golden Globe Awards - ArrivalsAnna just finished up hosting the Peoples Choice Awards, looking even more stunning with each new look she donned. And I’m happy to report she didn’t lose any fashionable steam here. I loved how breathtaking she looked in this nude embellished Reem Acra gown. And her accessories were spot on as well, coordinating nude Jimmy Choo heels and diamond earrings & a ring from Lorraine Schwartz.

JULIA LOUIS-DREYFUS 

72nd Annual Golden Globe Awards - Arrivals

Julia went for simplistic minimalism with this white, one-shoulder Narcisco Rodriguez. And I love it! The dress was amazing, just the right amount of sparkle on the bodice. It’s not always about the bells & whistles! She also kept it classy with her accessories, a few diamond pieces from Irene Neuwirth jewelry.

julia-louis-dreyfus-golden-globes-2015-02

I love this matching ivory & silver Edie Parker clutch she has used to accessorize her look. And below, you can take a look at some of the makeup Julia used to achieve her beauty look — slight brown smoky eye & nude lip, inclusive of some Chanel make-up.

julia-louis-dreyfus-golden-globes-2015-04Reese Witherspoon

REESE WITHERSPOON

I am loving all of these solid silver gowns, very disco ball-esque. And this is certainly inclusive of Reese’s strapless, fitted Calvin Klein custom dress. Reese has said this stunner took over 80 hours to make, but every hour was clearly worth it; this dress is simply amazing! And to add just a little more silvery shine, she accessorized with Tiffany & Co. jewelry, specifically a stunning diamond bangle, totaling about $1.5 million with all she was wearing!

reese-witherspoon-@reesewitherspoonReese’s beauty look was breathtaking. Her rosy flushed cheeks were courtesy of Kjaer Weis Cream Blush in Abundance, a pretty pink pout, thanks to Laura Mercier Crème Smooth Lip Colour in Merlot, and champagne and bronzy shimmer eyeshadows (also by Laura Mercier) were all showstopping. And finally, her tousled sideswept waves were courtesy of John Frieda.

569c82e361d4f0173b03cdfa98df91076b3ecace

KATE BECKINSALE

72nd Annual Golden Globe Awards - Arrivals

Kate always looks radiant. And she is of course shining like a bright star in this mixed media metallic & taupe Elie Saab greige gown. It has such a chic feel about it from the glittering bodice to the muted draped skirt. She is also coordinating perfectly with her accessories — silver Jimmy Choo heels, Rauwolf clutch, and diamond Lorraine Schwartz jewelry (bangles & dangling earrings).

kate-beckinsale-brightens-up-the-golden-globes-2015-red-carpet-01     kate-beckinsale-brightens-up-the-golden-globes-2015-red-carpet-06

kate-beckinsale-3-290

ALLISON WILLIAMS

Allison Williams

Allison was another lovely lady in fiery red. Her choice, an ombre beaded Armani Prive strapless gown with fitted bustier. She completed her look with Cartier diamonds, specifically a stunning diamond bracelet.

imageRetroglam for beauty looks was a very popular trend on the Golden Globes red carpet, mainly the hair. So here, makeup pro Gianpaolo Ceciliato wanted to “add a rock-’n’-roll edge to Allison’s Old Hollywood hairstyle and glamorous Armani Privé gown” with a bold smoky eye. He used St. Tropez’s One Night Only Instant Glow Body Lotion to give her a luminous, bronzy glow, and applied Giorgio Armani’s Eye Tints ($38) in #1 and #7  to create shimmery smoky eye. He rimmed the entire eye with a black pencil, and then layered the lid in black and gunmetal using Armani’s new liquid eye tints. “Then, I added a light beige to the inner corner and on the browbone to make the eye pop.”

011115-GG-katie-cassidy-640

KATIE CASSIDY

Katie is another lovely lady going with a super sexy look and it works. She perfectly struck the delicate balance of pulling off just the right amount of sexiness with this black Mikael D. dress. The details are superb, love the thigh high slit, starburst side cutouts, and silver touches. Black & silver continued on with her accessory choices — a black Rodo clutch and diamond Harry Kotlar jewelry.

TAYLOR SCHILLING

72nd Annual Golden Globe Awards - Arrivals

Taylor opted for another crimson red hue on the red carpet, her choice, a criss-cross strapped halter gown by Ralph Lauren. She looked very elegant. Matching perfectly with her gown were a crimson red Salvatore Ferragamo clutch and ruby Tiffany & Co. jewelry.

taylor-schilling-golden-globes-2015-02

Taylor Schilling’s Grace Kelly-inspired beauty look featured lips that perfectly matched her Ralph Lauren gown. Makeup artist Tina Turnbrow used Nars Red Square Velvet Matte Lip Pencil for lasting color. Her hair was also styled elegantly and very chic. Her hairstylist Ryan Trygstad, for Matrix, created a stylish chignon bun. He created the classic red carpet look with help from plenty of volumizing and anti-humidity products to ensure the twisted chignon would hold up all night.

taylor-schilling-3-290

LESLIE MANN

NBC's "72nd Annual Golden Globe Awards" - Arrivals

Yellow is a hard color, in my opinion, to pull off. Leslie made it work though with this fitted, strapless Kaufmanfranco number. It shines & shimmers all over and is the perfect shade for her. She paired it with a dark green Salvatore Ferragamo clutch and Kimberly McDonald jade earrings and gold bangles.

Her beauty look was radiant! Elizabeth Arden Beautiful Color Moisturizing Lipstick in Marigold paired perfectly with lit-from-within peachy glowing cheeks.

637c120e18e9495794104f327e02b711e1525fde

ELLIE KEMPER

Ellie KemperSupposedly this dress weighs 500 lbs! I’m not sure how she could wear this fully embellished silver Naeem Khan so well then, but needless to say, she does! It’s eye-catching and not in a bad way. I also love these gorgeous diamond jewelry pieces from Neil Lane — bracelets galore!

DAKOTA JOHNSON

72nd Annual Golden Globe Awards - Arrivals

Another disco ball-esque dress for me and yes, I love them all! Dakota looks amazing with her own take on this embellished type of dress, here a couture Chanel, strapless and with a high slit. It’s as if it was earmarked just for her! She is also donning some fine Chanel jewelry, namely a beautiful diamond ring. Silver is definitely the name of the game for her and it coordinates well, including her silver Jimmy Choo heels and Rauwolf clutch.

04efdc55e40249e5a4c9eae678f987980cdca70fDakota’s soft, luscious waves were simply beautiful! Hairstylist Mark Townsend gave her a “sexy and bendy” look, using  Dove’s Oxygen Moisture Root Lift Spray to add major volume at the roots, and R+Co’s Death Valley Dry Shampoo to get piecey texture.

To offset Johnson’s silver sequined Chanel gown, makeup artist Patti Dubroff decided to keep her face fresh, subtle, and polished. “We did flushed cheeks, bitten lips, and a subtle, defined eye in warm taupes and deep gray in the corner,” Dubroff says.  For a rosy glow, she applied Chanel’s Le Blush Crème de Chanel Cream Blush in Revelation on the apples of her cheeks.

72nd Annual Golden Globe Awards - Arrivals  KAT KRAMER

It’s almost as if you are in a bold crimson red, you’ve made my best dressed list! I’m not sure who Kat is wearing, but she looks gorgeous! I’m really enjoying this asymmetrical beaded gown. The fit is immaculate and Kat is exuding confidence, as well as looking great! Her accessories too are just as amazing, a coordinating red clutch and statement-making diamond jewelry.

72nd Annual Golden Globe Awards - Arrivals

JANE FONDA

011115-GG-jane-fonda-428

More red. More Versace. Gotta love it! Jane is pulling almost any look off these days. And she’s been wearing a lot of red, but each time, it still catches my attention in a new & fascinating way. This fitted red Versace gown, with sheer side pinned detailing is no different. She has paired with her look, silver Jimmy Choo “Aza” metallic pumps and a crimson red Rauwolf clutch.

Frances O’Connor

72nd Annual Golden Globe Awards - Arrivals

I will forever support the Project Runway franchise when I can. But here, there is no question former PR winner Leanne Marshall deserves a best dressed nod. This black strapless gown, with a sweetheart neckline and lace bodice, is divine. Frances made the right call here and was definitely a stand-out on the red carpet. She was also rockin’ some gorgeous diamond jewelry from Forevermark!

BEST DRESSED DUOS

I had to be a little nit-picky with making my best dressed list or it would really run on. So a few gorgeous ladies didn’t make the cut, but I couldn’t ignore how great they looked when standing next to their handsome and well-dressed men. So here are a few best dressed duos that really caught my attention. And together, their looks were amazing!

Jennifer Aniston & Justin Thoreaux

Justin Theroux, Jennifer AnistonJen is no stranger to wearing black on the red carpet, but you can never deny how gorgeous she looks. And without a doubt, next to her man, they make for a dynamic duo for sure! Jen is wearing a black YSL fitted dress, with a beaded bodice, and accessorizing with Neil Lane jewelry.

02520159d468f0e153092616b87c537da7a1821c

You can read more about Jen’s chic hair below, but her natural beauty look deserves some recognition as well. Aniston’s cheeks glowed with a combination of Chanel Le Blush Crème de Chanel in Destiny, then Chanel Le Blush Crème de Chanel in Intonation on apples of cheeks, finished with a dusting of bronzer Chanel Les Beiges Healthy Glow Sheer Colour in N°70. Her nude lips were courtesy of Chanel Precision Lip Definer in Mordoré-Nude and two coats of Chanel Rouge Coco Shine in Deauville.

1421084707_jennifer-aniston-560  jennifer-aniston-3-435

Jennifer is also rockin’ a very chic, classic updo in a very ladylike bun. “I kind of snuck it on her,” says Aniston’s hairstylist Chris McMillan. A few days ago, he showed her a picture of Kate Moss from Mario Testino’s book. “She was like, ‘Maybe…’ And if we do it up, we normally do a ponytail,” says McMillan. “So we were like let’s do makeup first and we’ll do a ponytail. She liked the shape of the ponytail, so while she was in the chair I wrapped the ponytail into a bun.” Aniston asked McMillan if it was weird that she liked it up. “I haven’t washed my hair in two days, but I love the texture,” McMillan says she said. “It was a 15 minute hairdo! We used Texture Spray by Living Proof and she was most happy when she realized, ‘I don’t have to deal with my hair all night!’”

CHANNING & JENNA DEWAN TATUM

72nd Annual Golden Globe Awards - Arrivals

This is another gorgeous pair, Channing as handsome as ever in a traditional black tuxe by Dolce & Gabbana. Jenna is shining bright in this strapless draped sunshine yellow Carolina Herrera dress. She is accessorizing with a burgundy Jimmy Choo clutch and diamond Lorraine Schwartz jewelry ($5 million worth)!!

main.original.0x971cJenna styled her hair in some very elegant waves. Her hairstylist, Bridget Bager for Matrix, wanted to create texture and movement. “The gown is so beautiful and grand, so we decided to soften her hair to offset the seriousness of the dress,” Bager says. The key is use a medium barrel curling iron, wrapping each section loosely and letting the ends drop.

Chrissy Teigen & John Legend 

72nd Annual Golden Globe Awards - Arrivals

Such a perfect pair, John in a classic black tuxe, and Chrissy in a long-sleeved, lacy embellished, blush pink Zuhair Murad sheath gown from the S/S 15 collection. Chrissy is accessorizing with a metallic Tyler Alexandra clutch, a Harry Kotlar radiant cut diamond ring and cushion cut pink and white diamond earrings (all in all, $1 million). as well as a diamond Suzanne Kalan ring.

main.original.0x971c

Chrissy’s hairstylist Giannandrea used Macadamia Professional’s Whipped Detailing Cream to create a beachy texture throughout her strands. All in all, creating this super chic high ponytail.

DIANE KRUGER & JOSHUA JACKSON

NBC's "72nd Annual Golden Globe Awards" - Red Carpet ArrivalsDiane & Joshua look amazing together, a match-made in heaven! Joshua is donning a classic black tuxe with bowtie, head to toe Berluti, while Diane is shining in a light metallic Emilia Wickstead fitted lurex gown with side train. She completed her look with an Emm Kuo clutch, and Kwiat & Marina B jewelry.

MATT BOMER

Matt is the epitome of looking like a true, handsome gentleman. He is statement-making for menswear in this navy blue Ralph Lauren Black Label tuxedo, complete with a black bow tie!

72nd-annual-golden-globe-awards-arrivals-1

MICHAEL KEATON

72nd Annual Golden Globe Awards - Arrivals

Not sure of his suit designer, but regardless, Michael is looking suave in his traditional black tuxe. He is wearing velvet Christian Louboutin smoking slippers though!