Fashion Nexus

A fashion blog for anything & everything fashion, including fashion law topics

Best Dressed — 2017 Emmy’s

My top looks for the 2017 Emmy Awards red carpet!!

JAIMIE ALEXANDER

JULIANNE HOUGH

VANESSA KIRBY

MANDY MOORE

RUBY MODINE

NASTIA LIUKIN

JENNIFER NETTLES

MADELINE BREWER

FELICITY HUFFMAN

GINA RODRIGUEZ

THANDIE NEWTON

SOFIA VERGARA

AMANDA CREW

ANNA FARIS

GUGU MBATHA-RAW

ZOE KRAVITZ

ANNA CHLUMSKY

ALEXIS BLEDEL

LEA MICHELE

LAURA DERN

MILLIE BOBBY BROWN

MICHELLE PFEIFFER

EMMY ROSSUM

TESSA THOMPSON

SAMIRA WILEY & LAUREN MORELLI

HILARIA & ALEC BALDWIN

JUSTIN HARTLEY

CALEB MCLAUGHLIN

JESSIE TYLER FERGUSON

JEREMY MAGUIRE

 

Which PR Designer took the Winning Leap!

I have not yet seen the film Leap!, but it is on my list! And mentioning that because it of course served as the inspiration for this week’s Project Runway challenge. After watching an extended trailer for the movie and a performance by fusion hip-hop pointe group Hiplet, Heidi & Tim provided the full challenge details!

Each designer would have 1 day and a $200 Mood budget to create a fashionable, innovative look in the spirit of dance/movement. It was a chance to get creative and inventive. While creative juices flowed, Deyonte had a painful sewing mishap, and Shawn/Claire were frantically running about the workroom. Tim was very pleased during his check-ins and it showed because this was one amazing runway! Dancer Maddie Ziegler picked a great week to guest judge!

Heidi announced how fantastic this runway was, which I agreed with wholeheartedly, but my top 3 was very different! From my own top 3 and the judges’, my winner of the week was Batani!

The judges, minus Zac, really got this look and I loved that they appreciated her amazing vision. This look really captured the spirit of dance/movement, and did so without being literal, and truly encapsulated movement!

I was hopeful the judges’ lackluster top 3 meant a clear path for Batani to win, but sadly, that was not the case. Happy she made the top 3, but a few other shout-outs for me —

I loved Ayana’s look! She is really impressing me each week and I’m happy to see such versatility with her work. This sparkly, tiered look very much dazzled me!

This dress is hottttt! Samantha killed it with this look and I would wear this 100%!

SHOUTOUTS — Avon hair & makeup

This was also a top look for me, from Kenya. Love the bold jacket, and the underneath part, being a jumpsuit, STUNNING!

SHOUTOUTS — Avon More glam from the team on hair & makeup

The judges top 3 included Brandon and Margarita, which I really didn’t get. And I was even more flabber-ghasted as to how Brandon won! He notes his lack of ability to speak is due to nerves, but I believe it is because he too is shocked by the judges’ decision!

I didn’t see this as a winning look, really fitting the challenge description. And then with Margarita, her look was way too literal. I didn’t care for the stark white fabric, kind of reminded me of the muslin. I did appreciate the pop of color as the judges did and there was movement, but it straight up looked like every other salsa ensemble I’ve seen — nothing too original here! But I do like Margarita so looking forward to more from her in the coming weeks.

The judges’ bottom 3 was Kudzanai, Kentaro, and Deyonte, and this did make sense. I was so worried the bottom 2 would be the case of the designer who did too much (Kudzanai) versus the designer who did too little (Kentaro), with the designer not doing enough going home. I love Kentaro and would have been so sad had he been axed this week. Given his background in dance/music, I did expect more from him. His work does fall under the minimalist umbrella, but he should have pushed it more this week, as Nina said, it needed a punch! Glad he was safe though and that we get to see more!

And then of course Deyonte being in the bottom 2, that was nerve-wrecking. But I kind of felt given his strong previous weeks, with a win week 1, that he would not be going home this soon! Of course his injury was going to be brought up, but as the judges noted, this unfortunate look was not all stemming from his injury. He chose an unflattering color. The silhouette was a yawn. And really, the look was not finished well, bit of a messy quality.

This left Kudzanai going home this week. I had not seen much from him yet that was truly impressive. He had been so safe and wanted to get the judges’ attention with this challenge, but he did way too much. The look was bright, it had many colors, feathers, other embellishments, very much all over the place. The judges too noted the messiness of the piece and sadly, this was not the best way to capture the judges’ attention.

Until next week…..

 

PR — Budgets, Wabi, Tsunamis Oh My!

I feel as if Project Runway, season 16, is going to be one super dramatic season! And starting off on that note, episode 2 brings us the first team challenge, which almost always brings some drama! The designers woke to safety gear — vests/helmets — and were off to meet Tim at the Royal Waste Services, a recycling & waste facility.

Joining Tim to lay out the challenge details was Anne Fulenwider, Editor in Chief of Marie Claire. For this challenge, there would be 3 teams. Each team would be creating a 5-piece mini collection. Each look would be made out of recyclable materials. So yes, not only was this a team challenge, but also unconventional materials. Each team would be recycling, reusing and restyling to create a high fashion transformation! The winning look from the winning team would be featured in Marie Claire for a piece on sustainability.

Team 1, aka “Wabi Sabi” — Kudzanai, Kentaro, Margarita, Michael, Deyonte — focus on structure, texture, and origami techniques

Team 2, aka “Ballin’ on a Budget” — Aaron, Batani, Brandon, Kenya, Ayana

Team 3, aka “Tsunami” — Sentell, Samantha, Amy, Claire, Shawn — translucency, seaglass focus

Tim reminded the designers that cohesion would be required. And this would be a 1-day challenge. Guest judges for the week were Anne Fulenwider and actress Maggie Q.

My ranking of the teams was different than the judges. I actually did not care for Ballin’ on a Budget. So for me, a toss up on them versus Tsunami for safety. But given the editing of the show, I think we all knew Tsunami was landing in the bottom! Since Wabi Sabi didn’t receive any accolade on the show, I will devote my attention to them here as they were my winning team! And Deyonte, Kentaro, or Margarita would have had the final win for me!

Loved Margarita’s silhouette here and the bottom portion was nicely detailed.

SHOUTOUTS FOR THE TEAM — JC Penney, love the red heels & Avon for gorgeous beauty look and I love the chic ponytail!

Simply stunning & beautiful work by Kentaro — love this guy!!

Love the volume and something different by way of silhouette than the repetition seen by some of the other designers. Another great job by Deyonte. He was clearly not resting on his laurels and relying on immunity!

Kudzanai’s look — nice show piece for the runway!

Probably my least fave of the collection, but the bodice detail embellishments were nice — Brandon

Team Wabi Sabi had a cohesive collection, but each designer still had their own POV. The judges, however, loved Ballin’ on a Budget. I thought the pieces read more arts and craft than recyclable fashion. The group said this was meant to be fashion on a budget, but all I saw was the budget part. I agreed with the judges naming Ayana as the winner of the group though.

Ayana’s look

I was too happy to see that Batani did better than last week!

But it was Tsunami who landed in the bottom. There was very little transformation. Example, trash bag dresses still looked like trash bags. I liked the color palette though. And there were some positives here. Amy’s look did not fit in as much with the rest of the collection, but I loved her look.

Amy impressed me week 1 and so did this look.

Also, shout-out for the group here. Loved all the choices, JC Penney’s heels, braided ponytail, gorgeous makeup from Avon.

Samantha too did a standout job here. The bodice of this dress was super sexy and the belt detail was a great touch. It was not enough to save the team though. I was confused on the bottom 2, except for knowing that there was no way PR was letting go of one of the twins this early. And seeing Shawn with Sentell in the bottom, I knew Sentell would be going.

The reason I stated confusion on the bottom 2 was because even though Shawn did not fair well under pressure this week, it was Claire’s look (above) that was one of the worst. I did love her look so much though last week, so glad she was not at risk in the bottom 2.

I guess Shawn was not feeling the vibe of the collection, but had she focused a bit more on this, it could have been much better!

But sadly, Sentell’s uninspired garbage bag dress was the loser of the week. Sentell did stand up for himself by stating what he did for Shawn’s look. But truth be told, each designer is responsible for their own individual design and final look. But another truth, even another hour on this was not going to to save it. I then remembered his look from last week and it was too unimpressive. I am just not sure Sentell was quite ready for the challenge of Project Runway!

 

Until next week…..

PR’s Super Sweet Sixteen!!

Excited that once again, it is Project Runway time! We were able to see many previews for this upcoming season — looks to be a dramatic, 16th season! The designers met each other during their welcome session, sipping on some Grey Goose “Espresso” martinis. Tim & Heidi soon joined, entering in super big style, specifically in a super gigantic RV. Heidi reminded the designers to expect the unexpected, and with that, we were in store for our first surprise!

This season, the models being used range from size 2 to size 22. The models also will get some airtime thru the use of a confessional mirror. Each week, the models rotate. Tim & Heidi wasted no time getting right into the first challenge. Each designer had to create a red carpet look, demonstrating their point of view as a designer. This was a 1-day challenge, with a $300 budget at Mood.

Huge sponsors for this season — PILOT, with the use of Friction erasable pens for sketching; Brother sewing & embroidery studio; JC Penney accessory wall; Avon for makeup & hair. Prizes for this season include the chance to collaborate with JC Penney to create a limited edition capsule collection; $40k prize pack thru Brother Sewing, including 2 industrial machines; a 2018 Lexus; all expense paid trip to Japan; a spread in Marie Claire; $100k, and more!

The Tim Gunn save is in play this season. And rounding out this week’s judging panel of Heidi Klum, Nina Garcia, and Zac Posen was actress Olivia Munn. The judges raved about the 1st runway. I thought there were some highlights, but I saw that many had an upwards trajectory for improvement ahead. Additionally, I don’t think some hit the mark on creating for the red carpet. But all in all, still an excellent runway!

I’m still wavering on my final top 3, but it would have been very different than the judges. But ultimately, I was 100% in agreement with the winner of the week, Deyonte. I could see his bold aesthetic coming thru in this look. Would this look be loved by everyone? No! But I could guarantee seeing it on red carpets now and it would make many best dressed lists.

Deyonte said Cannes, but I could see more. The flower placement perfection comment was spot on. This would be a look for a strong, confident woman.

Avon SHOUT-OUT — not for the hair, little matronly, but the makeup was beautiful!

 

Here are my other faves of the week, giving them a little shout-out!

So I actually know Shawn & Claire’s label and had no clue they would be on this season! I was not impressed this week with Shawn, but Claire’s look was gorgeous! Little more of a departure from the work I am used to from this design team, but if this is her solo voice, I LOVE IT! AVON SHOUTOUT — all around for beauty here, perfection!

I was surprised Amy impressed me this much on Week 1. I know she is known for quality and I saw that in this look. But I wondered what would set her apart from other minimalist designers? The ability to transform this look sold me! With more money and time, perhaps the top bra could have been a bit more elegant or sophisticated, but overall, job well done! AVON SHOUTOUT — love the bun, gorgeous makeup as well

A stand alone photo for Kentaro’s look doesn’t do it justice, but the movement here, the fascination attained as it walked the runway, deserves accolade! His previous work with drama and feminine beauty was a clear read in this first piece.

I was wondering what Ayana would, working with her cultural influences with each given challenge. I was impressed. A woman who wanted to don a head covering could really be a stand-out on the red carpet in this look. But additionally, even if this look was sans head covering, it would be super gorgeous. The floral embellishments were captivating.

Moving on to the judges’ faves. I was not surprised Kenya was in the top. I was surprised to see her more shock value aesthetic tamed in this challenge. Overall she did well, but it was not my fave. There was an elegance to this, but I had 2 reasons for keeping this out of my top, both of which the judges mentioned oddly enough! The bodice was a little wonky. And then something with the fabric choice perhaps, wasn’t making this dress look super high quality. But job well done for the 1st challenge!

Brandon struggled this week, so color me shocked that he was in the top. This was more on the bottom of my list! I think you could see it in his face he was confused on making the top as well. I wasn’t sure what red carpet I would see this on and really, this just lacked sophistication for me. Since he is safe, landing in the top, maybe this will give him confidence to forge ahead and impress me in future weeks.

The bottom 3 made more sense than the top. It seems as if Shawn & Claire will get much airtime this season, so I knew she wouldn’t be going home week 1. But this was disappointing to see from Shawn given her experience. She is all about being bold and modern, so I am hoping for more from her in weeks to come. The shorts were such a throwaway here, not making this fit for any red carpet. One of the judges said “club-by” and that was a good label for this.

Leaving ChaCha and Batani in the bottom 2, I was happy Batani was safe. I was so impressed with her previous work as well, so seeing this trainwreck was very disappointing. Even despite the mistakes seen/made, why was this her goal for the week. The color, the use of lace, doesn’t really seem like her forte or aesthetic. The back was worse than the front. And why did she lie about the hidden mistake/tear/hole!

This sadly left ChaCha out first, which anyone leaving first is always sad! He had such a great spirit. And with a wacky, interesting aesthetic, I would have enjoyed seeing a little more. Not sure he would have had the ability to stay for the long-haul, but seeing the fun exuberance wouldn’t have been bad for another week or two! But this look was not that exciting, very much a hot mess!

Until next week……

Tony’s & CMT Awards

Double the pleasure, double the fun, as is the case with my recent best dressed list, featuring my fave looks from both the 2017 Tony Awards and the 2017 CMT Awards. Enjoy!!

Carrie Underwood

Sara Bareilles

Liu Wen & Zac Posen

Clare Bowen

Sally Field

Wearing an elegant Christian Siriano

Denee Benton

Rachel Bay Jones

Tina Fey

Tina Fey in Sally LaPointe

Carly Pearce

Cynthia Erivo

Cristina Ottaviano

Cristina Ottaviano

Taye Diggs & Amanza Smith Brown

Amanza is wearing a stunning floral lace Jovani gown

Cobie Smulders

Amy Brown

Glenn Close

Bee Shaffer & Anna Wintour

Lady Antebellum

Ben Platt

Hunter Hayes

ASOS blazer & shirt

Jacob Davis

2017 CFDAs

The Council of Fashion Designers of America Awards (otherwise known as the Academy Awards of the fashion world) took place this pat week at Hammerstein Ballroom in New York City. The 2017 CFDAs, in partnership with Swarovski for the sixteenth year, was hosted by funny man Seth Meyers, who previously hosted the award ceremony in June 2012.

There were some notable presenters including Karen Elson and Amber Valletta, as well as Jon Bon Jovi’s giving the first-ever Swarovski Award for Positive Change to his good friend, designer Kenneth Cole.

According to Council of Fashion Designers of America’s site, the awards, which began in 1981, are the “highest honor in fashion and recognize the outstanding contributions made to American fashion in womenswear, menswear, and accessories as well as journalism, creative vision, personal style, and lifetime achievement.”

Sprinkled throughout this post are all the winners of the evening, as well as my top red carpet looks for the night!

Menswear Designer of the Year
WINNER: Raf Simons for Calvin Klein
Nominees: Robert Geller; Thom Browne; Tim Coppens; Todd Snyder

Meg Ryan

Kate Bosworth

Accessory Designer of the Year

WINNER: Stuart Vevers for Coach

Nominees: Irene Neuwirth; Rachel Mansur and Floriana Gavriel for Mansur Gavriel; Paul Andrew; Ashley and Mary-Kate Olsen for The Row

Diane Kruger

Lily Aldridge

Swarovski Award for Emerging Talent

Nominees: Laura Vassar and Kristopher Brock for Brock Collection; Gabriela Hearst; Virgil Abloh for Off-White; Sander Lak for Sies Marjan

WINNER: Laura Kim and Fernando Garcia for Monse

Olivia Munn

Joan Smalls

Womenswear Designer of the Year

WINNER: Raf Simons for Calvin Klein

Nominees: Marc Jacobs; Joseph Altuzarra; Jack McCollough and Lazaro Hernandez for Proenza Schouler; Ashley and Mary-Kate Olsen for The Row

Haim

Sailor Brinkley Cook

Elizabeth Chambers & Armie Hammer

Jac Jagaciak

Elsa Hosk

Alexi Ashe

The Founder’s Award: Pat McGrath

Board of Directors’ Tribute: Cecile Richards, Gloria Steinem and Janelle Monáe

Fashion Icon Award: Franca Sozzani, Italian Vogue editor-chief, posthumous

Proj. Runway — Who Won $50K!!

Well it’s more like not just who, but which two! In the setup for this week, an overall $50,000 was awarded and yes, that is actually half of the cash prize the winner of PR receives. Of course the winner gets a host more of other prizes, but $50K is still a pretty hefty prize!

pr15-ep9-1

Tim met with the designers to provide all of the details and joining him in the workroom was Barbara Shipley, Sr. VP of Brand Integration from AARP. AARP was the challenge sponsor, and ultimately who awarded the prize. As part of the challenge, the designers would be creating a look for a very special client and this look would be a part of representing that client’s next chapter. The special client turned out to be for each designer a family member or friend.

pr15-ep9-13

The winning look would not only awarded $25K to the designer, but another $25K to the client. This I believe was the first 2-day challenge of the season. And with that, the designers were off to Mood with a $250 budget.

pr15-ep9-26

When designers typically work with real world clients to that of models, sometimes issues or drama arises. This time there was not much of that with the exception of Jenni and her mom as their seemed to be confusion on the direction of the look. I wondered during Tim’s critiques though if he was being a little extra hard on Erin and Dexter? It was clear he thought Cornelius should not have gone home, only then assuming Erin or Dexter should have. He certainly didn’t hold back on critiques!

pr15-ep9-24

I believe the biggest workroom issue of the week however was Nathalia and really biting off more than she could chew. This week’s guest judges were fashion and beauty trendsetter Olivia Culpo and co-founder of Birchbox, Katia Beauchamp (who also is on the new Lifetime show, Project Runway: Fashion Start-Up).

pr15-ep9-40

The safe designers of the week were Laurence, Cornelius, and Dexter. I pretty much agreed with this result, but Dexter would have been in my top 3. His look was a knockout and really fit his client well. I thought he gave his friend exactly what she wanted, while still ringing very true to his designer aesthetic.

pr15-ep9-ds-final

SHOUTOUTS — Sally Beauty for a gorgeous, chic straight look & JustFab, love these killer blue booties

The judges’ top three was Roberi, Mah-Jing, & Rik. All were very deserving, but my winning look was Roberi. I got why they chose Rik, but Roberi, just as Dexter did, stuck true to his designer POV, all while giving his client a very fashion-forward look. I thought Rik’s dress was super great as well, but I’m not sure I really would have known it was his work in the midst of some very strong designer aesthetics.

pr15-ep9-rp-final

Roberi’s choice of prints and the ability to mix them together was genius. The look was fun and the pops of color were spot on!

JUSTFAB SHOUTOUT — More cute heels!!

Rik was certainly deserving of accolades though. His dress was very cute, perfect for his mom, not about the bells and whistles, but rather conveying a story, with very intricate details. It was very much age appropriate, but didn’t come across as a mature, mumsy creation.

pr15-ep9-rv-final

SHOUTOUTS — Sally Beauty, love the hair & Mary Kay, love the bold red lip

Mah-Jing certainly stepped it up though this week. His look was bad-ass. I didn’t get the same vibe as the judges that his mom was really working the look. I kind of thought it was wearing her and not the other way around. Perhaps in the right setting, but Mah-Jing really did give her what she wanted and he designed the look beautifully.

pr15-ep9-mjw-final

The bottom 3 was Erin, Nathalia, and Jenni. All who have been in the bottom before and all who unfortunately had the worst 3 looks of the week. Erin was again saved from the bottom two. If I’m not mistaken, every time she has been in the bottom, she has escaped the bottom 2 — very interesting. I wonder if she can find her way back to the top. I’m not seeing much by the way of improvement or growth from her the past few weeks, and she really is doing the same coat over and over again. And with this being a 2-day challenge, I would have expected her dress to have looked way better since we know she can do a coat easily in a day, if even that.

pr15-ep9-er-final

JUSTFAB SHOUTOUT — Gorgeous killer heels!

Nathalia escaped elimination this week, I believe her ideas were her saving grace. She attempted to do a lot and pretty much each article of clothing was poorly constructed. Everything read too oversized. She listened to her mom and the idea was there, but not fully conceived with regard to execution. I wish her coat had been longer and more fitting. I didn’t love the concept of a bell-bottom pant either. Jenni has had some success in the top so I would have picked her to stay in this scenario, but with 2 friends making up the bottom, sadness was inevitable.

pr15-ep9-nj-final

SALLY BEAUTY SHOUTOUT — Lovely waves!

pr15-ep9-39

So yes, with that, Jenni was out this week. Her look too had some construction issues, but a more major issue here was this look was not at all suited for her mom. It read “Jenni” 100%, but there wasn’t any adaptability to the client. I really wouldn’t see her mom wearing this at any of the events she mentioned. Jenni does have a strong aesthetic, but in terms of it being expansive and having the ability to be molded to different occasions, I’m just not sure she is there yet.

pr15-ep9-jr-final

Proj. Runway & Swimwear

pr15-ep4-4

This week, the Project Runway designers took on swimwear. With Tim being all decked out in a special ensemble, he & Heidi joined the designers on the runway to further show off more details on the challenge!

pr15-ep4-3

Each designer would create their own fabric to use in designing a stylish swimsuit & cover-up that would fit in with/be inspired by Heidi’s line, Heidi Klum Swimwear. The winning design would be sold as a part of the line.

pr15-ep4-10

To create the print, the designers would work with technical & digital experts. The designers would then head to Mood, with a budget of $100 for supplemental fabric, all for this 1-day challenge.

pr15-ep4-16

The episode began with a little hate-or-ade being spewed on Erin. Natural jealousies of course since she has won 2 challenges. Moving onto a little workroom drama, we first saw Cornelius having some difficulties with this swimwear challenge. Of course, as the episode progressed, we saw other designers were too facing trouble.

pr15-ep4-23

Heidi soon popped in, alongside Tim, for some critiques. Naturally, she had some pretty choice opinions. I was certainly ready to get the runway started! This week’s guest judge was model & author Lucky Blue Smith. So who rose to the occasion this week, and which designers sank?

pr15-ep4-44

Before the judges top & bottom 3, here are a few personal shoutouts of my own —

pr15-ep4-nj-final  Nathalia J — I thought the swimsuit was pretty cute, interesting print, Also, SHOUTOUT to both Mary Kay & Sally Beauty here, love the entire beauty look!!

pr15-ep4-co-final  Cornelius — SHOUTOUT again for both Mary Kay & Sally Beauty, another stunning glam, beauty look!

pr15-ep4-ds-final

Dexter — SHOUTOUTS — All areas, JustFab, killer heels, Mary Kay, love that pop of red on the lip, & Sally Beauty, curl-icious!

pr15-ep4-rv-final

On now to the judges top 3, getting right to the winner, since I was certainly in agreement with both the top 3 and the winner, let’s discuss Rik. The swimsuit, the cover-up, all super chic, and in black & white, LOVE! Also, SHOUTOUT to Mary Kay for this beautiful makeup look, very natural & fresh.

pr15-ep4-38

The judges almost gave the top spot to Alex, however my close 2nd would have been Roberi. I loved this print, it exuded such fun in the spirit and with all the colors.

pr15-ep4-rp-final

And then of course, as mentioned above, Alex was also in the top 3. I do think Alex did a great job. The cover-up here seemed more than just a cover-up, so I appreciate the effort he put into that piece. The overall look was very Grecian, and the trim of royal blue was the perfect pop of color!

pr15-ep4-as-final

Moving on now to the bottom 3, sadly, I don’t think Sarah should have been the one to go this week. I say sadly, because of this bottom 3, my choice would have unfortunately been Tasha. I just don’t think she did much here. Sarah’s print was a little more inventive and unique. I figured Jenni would be in the bottom because she dismissed Heidi’s suggestions, but this bikini was barely wearable. I do like Tasha, so I’m hoping she will bounce back!

pr15-ep4-th-final

Jenni, again, in the bottom, basically not listening to Heidi. I thought the coverup was interesting, and given the off coloring of Jenni’s print, I think she did her best to make it work.

pr15-ep4-jr-final

SHOUTOUT — Mary Kay, lovely beauty look

pr15-ep4-39

So that means Sarah was out and I do think that was unfortunate. She did a pretty decent job the week before, and I don’t think of the entire bunch, her swimsuit was the worst. The cover-up was not great, but let’s get real, a lot of other cover-ups were throwaways as well. And this print, it was very vintage, definitely something I can see as a print being used today.

pr15-ep4-sd-final

SHOUTOUTS — Mary Kay for the makeup look & Sally Beauty for the luscious curls!

pr15-ep4-43

2016 Emmys — Best Dressed

Took a bit longer to get this Best Dressed list out than usual. But of course, I had to do one for the 2016 Emmy Awards. Here are my faves —

KRISTEN BELL

kristen-bell-emmys-red-carpet-2016__opt

SARAH PAULSON

image

Makeup artist Adam Breuchaud emphasized Paulson’s created a metallic eye look using Eye Tint in Cold Copper topped with Eyes to Kill Intense Eyeshadow in #6, both by Giorgio Armani.

gallery-1474248916-sarah-paulson

NEVE CAMPBELL

rs_634x1024-160918163150-634-neve-campbell-cm-91816

neve-campbell-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

CONNIE BRITTON

68th Annual Primetime Emmy Awards - Arrivals

ALLISON JANNEY

Allison Janney

MEGALYN ECHIKUNWOKE

ima1ge

EMILY RATAJKOWSKI

emily-ratajkowski-best-dressed-emmys-2016

Makeup artist Hung Vanngo re-imagined the classic cat eye in iris-brightening jewel-tones. To get the look, try Line PRO Eye Pencil in Navy and Aqua, both by Lorac.

gallery-1474241458-emrata

CARLY CHAIKIN

gettyimages-607576856_master

ABIGAIL SPENCER

2016-emmys-abigail-spencer

EMILY ROBINSON

emily-robinson-68th-annual-emmy-awards-in-los-angeles-09-18-2016-3

SHIRI APPLEBY

2016-%20emmys-shiri-appleby

HOLLY TAYLOR

holly-taylor-at-68th-annual-primetime-emmy-awards-in-los-angeles-09-18-2016_1

holly-taylor-68th-annual-emmy-awards-in-los-angeles-09-18-2016-1_thumbnail

PADMA LAKSHMI

68th Annual Primetime Emmy Awards - Arrivals

im2age

Makeup artist Patrick Ta proves that fuchsia lips are more than a summer staple. To get the look he mixed two shades of Kat Von D Everlasting Liquid Lipsticks, bright lavender and hot pink.

gallery-1474247064-padma-lakshmi

NANCY O’DELL

a_4x-vertical

LARA SPENCER

68thannualprimetimeemmyawardsarrivalsk-kn3vs_p02x

FELICITY HUFFMAN & WILLIAM H. MACY

William H. Macy, Felicity Huffman

Felicity is wearing a stunning Tony Ward lace gown.

2016-emmys-felicity-huffman

TERRENCE HOWARD & MIRA PAK

gettyimages-607627800_master

MARIO LOPEZ

52588_mario-lopez-alfombra-roja-emmy-2016

ZAC POSEN

68th Annual Primetime Emmy Awards - Arrivals

PR — The Finale

So yes, finally getting around to blogging about the final eps of Project Runway and definitely just happy to get it over with at this point. I got behind on the episodes, but ultimately, I wasn’t feeling these final few shows of the season, all in all, quite disappointing. And the way everything ended up with the final 4, it certainly wasn’t making me jump to my computer to blog away. But as an avid PR fan, blog away, I must, and I did want to applaud one designer I was happy with this season — Kelly. She was my winner for the season. More on that later, but first, a bit on the episode before the finale (yep, definitely not dedicating 2 separate posts for this finale!).

pr14-ep13-episode15So of course as the almost finale began, it was clear Edmond would be saved, despite the edit attempts of it all being drawn out. Tim Gunn save used. The designers were headed home with 9k to create a 10 look collection. The Tim visit of course came sooner rather than later and the designers were quite eager.

pr14-ep13-episode12

Tim advised Ashley to keep her hand natural when designing and not to go too matronly. For Candice, he made sure to warn her about over-designing, to keep an editing eye. Kelly found a fan in Tim, but he asked that she make sure her looks had a luxe feel, not to go the cheap route. And finally, with Edmond, he was left with a lot of work to do as not much had been accomplished.

pr14-ep13-episode3

The designers were back to NY, Kelly feeling as if she was done, while Edmond still had 3 looks to complete and he was not even unpacking! Tim came by shortly after everyone had settled into the workroom. He told the designers they would present 3 looks to the judges for feedback. However, one of those looks had to be brand spankin’ new, created just in that 1 day. The designers were then headed to Mood with a budget of $250, which could be used in any way to enhance their collection. At Mood, we saw some zipper wars and Edmond somehow racking up a whopping $395, way over budget!! It was then again Tim-time.

pr14-ep13-episode9

Tim instructed Kelly to think of proportion and Ashley received this same critique. With Edmond, it was all about what to present to the judges. And with Candice, there was worry over cohesion. So at this point I would cut to the judges’ critique on the 3-look presentation, but I will save that for my final discussion on each collection. So instead, I will skip to the next segment right before the final collections were presented at Fashion Week. After the judges’ critiques, the designers had 2 days to get to work and many had lots of work to do, well…..according to the judges.

pr14-ep13-episode17

The final episode of the season began with Tim allowing the designers to hit up Mood once more. Tim himself would do the shopping. Ashley & Kelly only took part, with no objection from Candice or Edmond. Tim later went over the judges’ notes with each designer. Brian Bolain of Lexus popped in to let the designers know they could make use of 2 Lexus coops to arrive in style for their shows. Lots of last minute craziness was of course occurring in this episode. But as per usual, everything seemed to go off without a hitch. And the guest judge on the presentations of the final 4 was country music superstar Carrie Underwood.

pr14-ep14-episode37

So without further delay, let’s get to the most important part of the finale of PR — the fashion week presentations. Ashley won, but I am going to begin with my choice for the winner, Kelly!

pr14-ep14-episode15

After the judges’ initial critiques I was afraid Kelly would drastically change up her collection as Candice did and that would have been such a shame. Kelly is a really cool designer and this is a very hip collection. I am not sure I can rock all of Kelly’s looks, but they do make me kind of want to try. Kelly is all about experimentation and she very much makes me want to experiment with my own fashion choices.

pr14-ep14-kd2

Kelly was the designer who stayed most true to herself. She has such a clear vision. She has a type of girl and this girl will go and buy these pieces. She has a unique spirit and you can see that in her work. Her styling was also very spot on, just such great work on the accessories, the hair (Sally Beauty), and the makeup (Mary Kay) — it was all spectacular.

pr14-ep14-kd3

When it came down to the judges thoughts, early on, Nina was quick to quip that she couldn’t tell what garment was made in only a day, because what she saw, it was hard to tell. She also said that this didn’t feel like a collection that was 9k worth. How the judges could think this, but somehow feel as if their winner Ashley’s collection looked like 9k, mind boggling! Like seriously! I think the tip to amp up the styling was a good thought, but overall, Kelly was lacking in judges’ support and the producers when it would come to naming her as the winner. There were other plans in mind!

pr14-ep14-kd6

But overall I applaud Kelly for staying true to herself all season. She was a dark horse and coming in 2nd was a huge accomplishment for her. I will definitely be keeping an eye on this talented lady in the future!

pr14-ep14-kd10

pr14-ep14-episode24

I wish Candice had channeled some Kelly vibes when it came to her final presentation. I will still keep an eye out for Candice in the future, but her major downfall in this finale was listening to the judges in their initial critique. Her collection could have used some downplay, but taking out most, if not all of the drama, spice, and intrigue was a major mistake. She had some highlights still, but her moment felt much more blah without the full on Candice I’m sure we all wanted to see.

pr14-ep14-episode20

If the winner was always going to be Ashley, even if Candice had gone full on in her presentation, it wouldn’t have gotten her the win, but it would have made her way more memorable. Having seen what was there before, it just really made me want more. I really just wanted to see that big ole’ dress she made, hoop skirt and all walk the runway!

ranking-the-10-best-

And I think the last minute changes led to some of what the judges later critiqued on, which was fit issues. I’m not sure what the judges were going on about with cohesion. I totally still saw Candice in what she presented. And had she done it the way she initially intended, I think the cohesive elements would have in fact been stronger.

pr14-ep14-cc6

I’m sure she will present again and I’m sure she will not let anyone hold her back this time! But another great bit of work here from the Mary Kay team, Sally Beauty squad, and Just Fab accessories!

pr14-ep14-cc8

pr14-ep14-cc10

Edmond, sadly, was the throwaway of the final 4. He started out so strong this season, but started to lag in the final few challenges. Tim Gunn had a save to use and thus he was saved. But based on this collection, it was not needed. The judges’ critiques early on were about ampin’ up the sexy vibe they had come to know from Edmond. But that was my biggest issue I had with his final pieces — where and who was Edmond??

pr14-ep14-episode18

I’m not sure based off these final pieces if I could pick an Edmond original out in the future. This collection left me wondering who he is as a designer. There were some pretty dresses here, but nothing inventive or too creative. In fact, the one piece I adored the most from Edmond, below, is the one I see as the least like him of the bunch.

pr14-ep14-en6

More gorgeous work from Mary Kay, Sally Beauty and the Just Fab accessories!

pr14-ep14-en2

This work reminded me of Edmond’s Just Fab challenge win — the sexy red dress. It was a gorgeous dress, so sexy, so wearable, but a bit of a snooze-fest in the way of being unique. Nothing really here knocked me out of my socks or was that intriguing. I wasn’t taking too many 2nd glances. I’m sure a lot of women would want to wear some of these dresses, but likely wouldn’t know who they were wearing. It wouldn’t me memorable enough for them to want repeat looks by the designer.

pr14-ep14-en9

pr14-ep14-en10

This leaves us with discussing the winner of Project Runway this season, Ashley. I have loved so many of Ashley’s looks this season. But as the season dwindled down, I became less and less of a fan. There always seemed to be so much drama and so many tears. I was kind of over it after a bit. And then came her final presentation — a first ever for PR, a plus size collection. I applaud the effort and I was happy she went for it, but to me, she came up sub-par.

pr14-ep14-episode13

I know I am not the only one to think this or to even say it, but Ashley won this season solely so PR could get the headline — “First plus-size designer wins PR.” It was all about the press and the headline because it surely wasn’t about these pieces. It was an okay collection, but there were so many fit issues and so many flaws. There were very few standouts. I was also unimpressed by the repetition — lots of crop tops and skirts — yawnnnnnn!

pr14-ep14-at6

And the only way I think 9k was utilized on this collection was because of the headpieces. They were gorgeous and looked more thought out than some of pieces. But yes, we sure had to hear enough about them. I think Ashley missed out by not using any prints, but many of these pieces didn’t feel luxe to me. And I again point out the flaws — all of the shorts were so ill-fitting.

pr14-ep14-at7

The color palette didn’t lend a hand in that department either, so many baby pinks and light teals, left the collection lacking in a rich, special quality. The exception is this look below, which was oddly enough the one she banged out in a day. The deep color was beautiful and the overall quality was heightened.

-project-runway--se4a

One other standout was the floral motif skirt below and it was a bit of a showpiece, but one of very few that looked like work was put into it and even some of that 9k.

pr14-ep14-episode25

I digress again, it seemed as if the end was predetermined — that a larger vision was in the midst. It’s happened before where the winner was a bit questionable and I’m sure it will happen again in the future. But for an overall disappointing season, I didn’t expect much here.

ranking-the-10-be2st-

A final rant/note then on reunion episode, which of course was filled with some laughs, drama, and intriguing aspects. But of course the focus was back to the most drama-filled episode this season, we all know it, the “Mean Girls” episode. And yes, I use quotation marks because I questioned the episode back then and still question the big deal over it now. I loved that it was pointed out that the girls were all being judged, yet none of the guys got called out for not picking Ashley. I don’t care if they had a plan to not do so. If she was such a great designer, one whom everyone should have wanted to work with, how only the female cast should take the blame is beyond ridiculous. She didn’t lend much to the creative process and her look was pretty much crap that week. It was one of the worst ones, so she should have taken some heat on this. She had already gotten one free ride from the Hallmark challenge, so to see her put out another bad look on the runway was clearly an issue in my opinion. It seemed to me as if all of a sudden, just this episode, those few girls were dubbed as mean girls, no mention of this before and really there was no evidence of anything shown in the episode where these girls were badmouthing Ashley or treating her so poorly. If the drama was there, the producers would have shown more. It was such a stretch. And then poof, it was all soon forgotten. No more mean girls the rest of the season, yet somehow, in the reunion episode, it was all brought up again.

Very much ready at this point for All-stars, next season, anything to get true competitive juices flowing again!